PeppiLibrary

Healing

TB-500 peptide reference

Synthetic fragment of thymosin beta-4. Long half-life, weekly dosing.

Last reviewed May 6, 2026 Human data Not FDA approved
Peppi reviewing TB-500 notes
Default dose label2 mg
Preferred routeSubQ
Frequency label1–2× weekly
Storage window60 days mixed

Evidence snapshot

Human data

Evidence maturityHuman data
Animal studies + limited human (mostly racehorse and veterinary use)

Research chemical / banned in most competitive sports (WADA)

Route map

How records are usually labeled

1 SubQ
2 IM

Rotate sites for systemic effect; injection near injury is not required given long half-life.

Vial timeline

Storage cues to log

Before mixSealed lyophilized powder: refrigerate 2–8 °C; freeze for long-term.
After mixRefrigerate 2–8 °C, use within 60 days.
Use-by cue60 days after mixing
Mixed vial window60 days
Use this as a record-keeping cue, not a replacement for product labeling.

Peppi workflow

From vial to review

Vial 5 mg vial
Dose 2 mg
Route SubQ
Review 60d storage

Peppi turns scattered dose, vial, route, storage, note, and report details into one record trail.

Educational reference only

This page helps you understand what to track for TB-500. It is not medical advice, a prescription, or a recommendation to use this peptide. Discuss dose, route, timing, storage, and safety with a qualified healthcare professional.

Overview

TB-500 is a synthetic peptide based on the active region of thymosin beta-4 (TB4), a naturally occurring 43-amino-acid peptide. It is researched for systemic recovery — particularly tendon, muscle and cardiac tissue repair — and is frequently stacked with BPC-157. Its long effective half-life means weekly dosing is standard rather than daily.

Also known as: Thymosin Beta-4 fragment, TB4 fragment.

Systemic soft-tissue recoveryTendon and muscle repairCardiac tissue researchHair regrowth (anecdotal)

Mechanism and timing snapshot

Sequesters G-actin to regulate cytoskeletal dynamics; promotes cell migration, angiogenesis, stem-cell mobilisation, and downregulates inflammatory cytokines.

Onset labelNot listed
Catalog onset field, when available.
Half-life label60 hr
Effective biological half-life ~2.5–3 days due to actin binding
Duration label168 hr
Catalog duration field, when available.
subQ High
IM High
oral Negligible

Tracking defaults

These values come from Peppi's catalog so records can be prefilled consistently. They should be reviewed against your clinician's instructions before logging real-world use.

Catalog default dose2 mg
Catalog dose range2 mg - 10 mg
Default routeSubQ
Frequency label1–2× weekly
Best time labelAnytime; consistency of weekly cadence matters more than time of day.
Food noteNone.

Catalog protocol note

Loading: 2 mg subQ 2× per week for 4–6 weeks, then maintenance at 2 mg every 1–2 weeks.

Routes and site notes

Available route labelsSubQ, IM
Preferred route labelSubQ
Common site labelsAbdomen, Glute, Thigh
Site rotation noteRotate sites for systemic effect; injection near injury is not required given long half-life.

Chemistry

SequenceLKKTETQ (active fragment) / SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (full TB4)
Amino acids43
Molecular formulaC212H350N56O78S
Molecular weight4963 Da

Vial, reconstitution, and storage

Supply formLyophilized powder
Typical vial size5 mg
DiluentBacteriostatic water
Diluent volume2.5 mL
Concentration note5 mg in 2.5 mL → 1.0 mL = 2 mg (100 units on a 100-unit insulin syringe).
Before reconstitutionSealed lyophilized powder: refrigerate 2–8 °C; freeze for long-term.
After reconstitutionRefrigerate 2–8 °C, use within 60 days.
Reconstituted shelf life60 days
Light sensitiveYes
Freeze/thaw warningYes

Safety notes

Common and rare side effects listed in the catalog

  • Mild lethargy in first 1–2 weeks
  • Head-rush or warmth shortly after injection
  • Injection-site bruising
  • Transient hypotension

Contraindications and warnings

  • Active malignancy (theoretical — increases cell migration)
  • Not approved for human use by the FDA — sold as research-only.

Other considerations

  • Long half-life means missing a dose by a day rarely matters.
  • Loading phase produces more noticeable subjective effects than maintenance.

Evidence and regulatory context

Evidence levelAnimal studies + limited human (mostly racehorse and veterinary use)
FDA approvedNo
Regulatory statusResearch chemical / banned in most competitive sports (WADA)
Prescription requiredNo
Approved countriesNot listed

Stacking and cycle notes

Stacks well withbpc-157
Avoid combining noteNot listed
Typical cycle label4–8 (loading) + 4–8 (maintenance)
Typical break label4+
Cycle guidanceFront-load with 2× weekly dosing for 4–6 weeks, then taper to weekly maintenance. Take an extended break before another loading cycle.

Tracking tips

  • Banned by WADA — disqualifying for competitive athletes subject to drug testing.
  • Pairs with BPC-157 for compound healing stacks.
  • Weekly cadence — set a recurring reminder so you don't drift.

References

Track it in Peppi

Keep TB-500 records organized.

Use Peppi for dose logs, vial inventory, storage dates, reminders, journal notes, photos, and clinician-ready reports.

Download on theApp Store Get it onGoogle Play

FAQ

What should I track for TB-500?

Track the peptide name, dose amount and unit, route, vial label, timing, reconstitution or expiration dates, storage notes, and any symptoms or questions for clinician review.

Does Peppi tell me how to use TB-500?

No. Peppi organizes educational reference and your own records. Protocol decisions should come from a qualified healthcare professional.

Can I export TB-500 records?

Peppi is designed to keep dose logs, vial inventory, journal notes, and reports easier to review and export.

Last reviewed: May 6, 2026